Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SARS-CoV-2 Non-structural protein 9/NSP9 Protein (His)

SKU: orb1976430

Description

SARS-CoV-2 Non-structural protein 9/NSP9 Protein (His) is expressed in E. coli.

Research Area

,Recombinant-Protein

Images & Validation

Application Notes
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Key Properties

Expression SystemE. coli
Biological OriginSARS-CoV-2
Biological ActivitySARS-CoV-2 Non-structural protein 9/NSP9 Protein (His) is expressed in E. coli.
TagC-10xHis
Expression Region1-113 aa
MW13.9 kDa (predicted)
Purity98.00%
Protein SequenceNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ

Storage & Handling

Storage-20°C
Expiration Date6 months from date of receipt.
DisclaimerFor research use only
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

20 μg
$ 300.00
100 μg
$ 490.00
1 mg
$ 1,780.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry