You have no items in your shopping cart.
Description
Research Area
,Product Categories/Proteins
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Purity | Protein is > 95% pure as determined by 10% PAGE (coomassie staining). |
| Protein Sequence | EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYHHHHHH |
Storage & Handling
−| Storage | Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile filtered clear solution. |
| Buffer/Preservatives | SARS MERS protein solution is supplied in PBS, 25mM arginine and 0.05% sodium azide. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−
SARS MERS RBD Protein [orb753194]
Greater than 90.0% as determined by SDS-PAGE.
Sf9, Baculovirus cells
10 μg, 2 μg, 1 mgSARS MERS S2 Protein [orb753193]
Greater than 85.0% as determined by SDS-PAGE.
Sf9, Baculovirus cells
2 μg, 10 μg, 1 mgSARS MERS (18-751) Protein [orb753192]
Greater than 85.0% as determined by SDS-PAGE.
Sf9, Baculovirus cells
10 μg, 1 mg, 2 μgSARS MERS Protein [orb753191]
Greater than 85.0% as determined by SDS-PAGE.
Sf9, Baculovirus cells
1 mg, 2 μg, 10 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
SARS MERS Protein (orb428303)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days