You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | ELISA, IF, IHC-P, WB |
|---|---|
| Reactivity | Human |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG2a kappa |
| Clone No. | 1H4 |
| Immunogen | SARS (AAH00716, 1 a.a. ~ 514 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTLENRLQNMEVTDA |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Detection limit for recombinant GST tagged SARS is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to SARS on HeLa cell. [antibody concentration 25 ug/ml]

Immunoperoxidase of monoclonal antibody to SARS on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 3 ug/ml]

SARS monoclonal antibody (M01), clone 1H4 Western Blot analysis of SARS expression in Jurkat.

Western Blot analysis of SARS expression in transfected 293T cell line by SARS monoclonal antibody (M01), clone 1H4. Lane 1: SARS transfected lysate (58.8 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of SARS over-expressed 293 cell line, cotransfected with SARS Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with SARS monoclonal antibody (M01), clone 1H4 (Cat # orb2292209). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (82.28 KDa).
Documents Download
Request a Document
Protocol Information
SARS monoclonal antibody (M01), clone 1H4 (orb2292209)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review