You have no items in your shopping cart.
Severe acute respiratory syndrome coronavirus 2 Non-structural protein 3 protein
SKU: orb668869
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Non-Animal,Infectious Diseases,Signal Transduction
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) |
| Tag | N-terminal 10xHis-tagged |
| Expression Region | 746-1060aa |
| Protein Length | Partial(Partial of YP_009725299.1 nsp3) |
| Endotoxins | Not test. |
| MW | 41.7 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−PL2-PRO Papain-like proteinase PL-PRO SARS coronavirus main proteinase
Similar Products
−Recombinant Severe acute respiratory syndrome coronavirus 3C-like proteinase, partial [orb1096654]
Greater than 85% as determined by SDS-PAGE.
35.8 kDa
in vitro E.coli expression system
20 μg, 100 μgRecombinant Severe acute respiratory syndrome coronavirus 2 Replicase polyprotein 1ab (rep) [orb1674352]
Greater than 85% as determined by SDS-PAGE.
92.3 kDa
Yeast
1 mg, 20 μg, 100 μgRecombinant Severe acute respiratory syndrome coronavirus 2 Replicase polyprotein 1ab (rep) [orb1674575]
Greater than 85% as determined by SDS-PAGE.
70.0 kDa
Baculovirus
1 mg, 20 μg, 100 μgSARS-CoV-2 Papain-Like Protease Protein [orb1960910]
98.00%
34 KDa (reducing condition)
50 μg, 500 μg, 10 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks