SFPQ monoclonal antibody (M02), clone 6D7

SKU: orb2292196

Description

Mouse monoclonal antibody raised against a partial recombinant SFPQ.

Images & Validation

• Tested Applications: ELISA, IF, IHC-P, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone No.: 6D7
• Immunogen: SFPQ (NP_005057, 269 a.a. ~ 361 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: EEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGRQ
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged SFPQ is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to SFPQ on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to SFPQ on formalin-fixed paraffin-embedded human thyroid nodular goiter. [antibody concentration 3 ug/ml]

SFPQ monoclonal antibody (M02), clone 6D7 Western Blot analysis of SFPQ expression in Hela S3 NE.

Western Blot detection against Immunogen (35.97 KDa).

Quick Database Links

RefSeq (Protein):NP_005057