You have no items in your shopping cart.
Description
Research Area
,Recombinant-Protein
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Expression System | P. pastoris (Yeast) |
|---|---|
| Biological Origin | Human |
| Biological Activity | Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. SFTPB Protein, Human, Recombinant is expressed in yeast. The predicted molecular weight is 8.7 kDa and the accession number is P07988. |
| Tag | Tag Free |
| Expression Region | 201-279 aa |
| MW | 8.7 kDa (predicted) |
| Purity | 98.00% |
| Protein Sequence | FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−- Item 1 of 1
Human SFTPB protein [orb595023]
Greater than 85% as determined by SDS-PAGE.
50.7 kDa
Baculovirus
1 mg, 20 μg, 100 μgHuman SFTPB protein [orb418979]
Greater than 90% as determined by SDS-PAGE.
8.7 kDa
Yeast
1 mg, 20 μg, 100 μgHuman SFTPB protein [orb419270]
Greater than 90% as determined by SDS-PAGE.
24.7 kDa
in vitro E.coli expression system
20 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days