SHC1 monoclonal antibody (M01), clone 3F4

SKU: orb2292183

Description

Mouse monoclonal antibody raised against a partial recombinant SHC1.

Images & Validation

• Tested Applications: ELISA, IF, IHC-P, PLA, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 Kappa
• Clone No.: 3F4
• Immunogen: SHC1 (AAH33925, 171 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: QTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRELFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMAEQLRGEPWFHGKLS
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged SHC1 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to SHC1 on A-431 cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to SHC1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1 ug/ml]

Proximity Ligation Analysis of protein-protein interactions between PIK3R1 and SHC1. HeLa cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-SHC1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Proximity Ligation Analysis of protein-protein interactions between PIK3R1 and SHC1. Huh7 cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-SHC1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Proximity Ligation Analysis of protein-protein interactions between STAT5A and SHC1. Mahlavu cells were stained with anti-STAT5A rabbit purified polyclonal 1:1200 and anti-SHC1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

SHC1 monoclonal antibody (M01), clone 3F4 Western Blot analysis of SHC1 expression in A-431.

Western Blot detection against Immunogen (37.73 KDa).

Quick Database Links

RefSeq:AAH33925