You have no items in your shopping cart.
Description
Research Area
Product Categories/Products/Antibodies
Images & Validation
−
| Tested Applications | IHC, IHC-P, WB |
|---|---|
| Dilution Range | IHC, IHC-P (1:100), WB (1:500 - 1:2000) |
| Reactivity | Human |
| Application Notes |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SIVA1 (NP_068355.1). MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET |
| Target | SIVA1 / SIVA |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol |
| Concentration | 1.75 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−SIVA1, CD27BP, CD27-binding (Siva) protein, Siva-1, SIVA, Siva-2, CD27-binding protein
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
SIVA1 / SIVA
Protocol Information
WB
Western Blot (IB, immunoblot)
IHC
Immunohistochemistry
IHC-P
Immunohistochemistry Paraffin
Available Sizes
Select a size below
Free Secondary Antibody (20 ul)0/0
Please add an antibody product to your cart first.
Usually dispatched within 2-3 weeks