SLC17A6 Protein, Rat, Recombinant (His)

SKU: orb1976520

Description

Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. May also mediate the transport of inorganic phosphate. Involved in the regulation of retinal hyaloid vessel regression during postnatal development. May also play a role in the endocrine glutamatergic system of other tissues such as pineal gland and pancreas. SLC17A6 Protein, Rat, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 11.1 kDa and the accession number is Q9JI12.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: Rat
• Biological Activity: Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. May also mediate the transport of inorganic phosphate. Involved in the regulation of retinal hyaloid vessel regression during postnatal development. May also play a role in the endocrine glutamatergic system of other tissues such as pineal gland and pancreas. SLC17A6 Protein, Rat, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 11.1 kDa and the accession number is Q9JI12.
• Tag: C-6xHis
• Expression Region: 499-582 aa
• MW: 11.1 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: SGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATSQENGGWPNGWEKKEEFVQESAQDAYSYKDRDDYS

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

Q9JI12