Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SLC33A1 Rabbit Polyclonal Antibody

SKU: orb578976

Description

Rabbit polyclonal antibody to SLC33A1

Research Area

Product Categories/Antibodies/Primary Antibodies,Neuroscience,Epigenetics,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Membrane Protein,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Enhanced Validation Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SLC33A1
TargetSLC33A1
Protein SequenceSynthetic peptide located within the following region: CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG
Molecular Weight61 kDa
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

AT1, AT-1, ACATN, SPG42, CCHLND

Similar Products

  • SLC33A1 Rabbit Polyclonal Antibody (FITC) [orb14242]

    IF

    Human, Rat

    Mouse

    Rabbit

    Polyclonal

    FITC

    100 μl
  • SLC33A1 Polyclonal Antibody [orb1421429]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • SLC33A1 Rabbit Polyclonal Antibody [orb13687]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Human, Rat

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • SLC33A1 [orb1277270]

    WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • SLC33A1 [orb1284162]

    WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SLC33A1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide sequence is also contained within a 29 kDa isoform of the protein.

SLC33A1 Rabbit Polyclonal Antibody

Sample Type: Hela, Antibody Dilution: 1.0 ug/ml. SLC33A1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.

SLC33A1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

SLC33A1 Rabbit Polyclonal Antibody

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 2 ug/ml.

SLC33A1 Rabbit Polyclonal Antibody

Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml. SLC33A1 is supported by BioGPS gene expression data to be expressed in 721_B.

SLC33A1 Rabbit Polyclonal Antibody

Positive control (+): Human Placenta (PL), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.

SLC33A1 Rabbit Polyclonal Antibody

Rabbit Anti-SLC33A1 Antibody, Catalog Number: orb578976, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Membrane, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

SLC33A1 Rabbit Polyclonal Antibody

Rabbit Anti-SLC33A1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Adult Small intestine, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

SLC33A1 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

SLC33A1 Rabbit Polyclonal Antibody

WB Suggested Anti-SLC33A1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Placenta.

SLC33A1 Rabbit Polyclonal Antibody

WB Suggested Anti-SLC33A1 antibody Titration: 1 ug/ml, Sample Type: Human heart.

SLC33A1 Rabbit Polyclonal Antibody

WB Suggested Anti-SLC33A1 antibody Titration: 1 ug/ml, Sample Type: Human liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004724

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

SLC33A1 Rabbit Polyclonal Antibody (orb578976)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry