SLC33A1 monoclonal antibody (M07), clone 3A4

SKU: orb2291754

Description

Mouse monoclonal antibody raised against a partial recombinant SLC33A1.

Images & Validation

• Tested Applications: ELISA, WB
• Reactivity: Human, Rat

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone No.: 3A4
• Immunogen: SLC33A1 (NP_004724, 1 a.a. ~ 69 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFR
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged SLC33A1 is 0.03 ng/ml as a capture antibody.

SLC33A1 monoclonal antibody (M07), clone 3A4 Western Blot analysis of SLC33A1 expression in PC-12.

Western Blot analysis of SLC33A1 expression in transfected 293T cell line by SLC33A1 monoclonal antibody (M07), clone 3A4. Lane 1: SLC33A1 transfected lysate (60.9 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of SLC33A1 over-expressed 293 cell line, cotransfected with SLC33A1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with SLC33A1 monoclonal antibody (M07), clone 3A4 (Cat # orb2291754). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (33.33 KDa).

Quick Database Links

RefSeq (Protein):NP_004724