SLC7A5 Protein, Human, Recombinant (His & Myc & SUMO)

SKU: orb1978311

Description

SLC7A5 Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 19.7 kDa and the accession number is Q01650.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Key Properties

• Expression System: E. coli
• Biological Origin: Human
• Biological Activity: SLC7A5 Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 19.7 kDa and the accession number is Q01650.
• Tag: N-10xHis-SUMO, C-Myc
• Expression Region: 16-50 aa
• MW: 19.7 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

Q01650