You have no items in your shopping cart.
Description
Research Area
Product Categories/Antibodies/Primary Antibodies,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Lymphocyte Signaling,Root Catalog/Research Areas/E3 & Ubiquitin,Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions,Root Catalog/Research Areas/JAK-STAT,Root Catalog/Research Areas/Cell Differentiation,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Mouse, Porcine, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SOCS7 |
| Target | SOCS7 |
| Protein Sequence | Synthetic peptide located within the following region: LDPKALPPGLALERTWGPAAGLEAQLAALGLGQPAGPGVKTVGGGCCPCP |
| Molecular Weight | 64kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti NAP4 antibody, anti NCKAP4 antibody
Similar Products
−SOCS7 Rabbit Polyclonal Antibody [orb313242]
IF, IHC-Fr, IHC-P, WB
Rabbit
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].






![SOCS4 antibody [C3], C-term](/images/pub/media/catalog/product/s/o/socs4-antibody_orb556197_ifa_1.jpg)
![SOCS4 antibody [C3], C-term](/images/pub/media/catalog/product/s/o/socs4-antibody_orb556197_ihc_1.jpg)
![SOCS4 antibody [C3], C-term](/images/pub/media/catalog/product/s/o/socs4-antibody_orb556197_wb_1.jpg)




