SOD1 Protein, Mouse, Recombinant (His)

SKU: orb1977002

Description

Destroys radicals which are normally produced within the cells and which are toxic to biological systems. SOD1 Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 17.8 kDa and the accession number is P08228.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: Mouse
• Biological Activity: Destroys radicals which are normally produced within the cells and which are toxic to biological systems. SOD1 Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 17.8 kDa and the accession number is P08228.
• Tag: N-6xHis
• Expression Region: 2-154 aa
• MW: 17.8 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: AMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSKKHGGPADEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P08228