SORD monoclonal antibody (M01), clone 4D3

SKU: orb2292147

Description

Mouse monoclonal antibody raised against a partial recombinant SORD.

Images & Validation

• Tested Applications: ELISA, IHC-P, WB
• Reactivity: Human, Mouse, Rat

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 Kappa
• Clone No.: 4D3
• Immunogen: SORD (NP_003095, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGR
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged SORD is approximately 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to SORD on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.2 ug/ml]

SORD monoclonal antibody (M01), clone 4D3 Western Blot analysis of SORD expression in Hela S3 NE.

SORD monoclonal antibody (M01), clone 4D3. Western Blot analysis of SORD expression in NIH/3T3.

SORD monoclonal antibody (M01), clone 4D3. Western Blot analysis of SORD expression in PC-12.

SORD monoclonal antibody (M01), clone 4D3. Western Blot analysis of SORD expression in Raw 264.7.

Western Blot analysis of SORD expression in transfected 293T cell line by SORD monoclonal antibody (M01), clone 4D3. Lane 1: SORD transfected lysate (38.165 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).

Quick Database Links

RefSeq (Protein):NP_003095