Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SOX2 Rabbit Polyclonal Antibody

SKU: orb576582

Description

Rabbit polyclonal antibody to SOX2

Research Area

Product Categories/Antibodies/Primary Antibodies,Epigenetics,Product Categories/Antibodies,Developmental Biology,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Transcription Factor,Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation,Root Catalog/Research Areas/Developmental Biology,Root Catalog/Research Areas/Neuroscience,Root Catalog/Research Areas/Stem Cells,Root Catalog/Research Areas/Immunohistochemistry,Root Catalog/Research Areas/Transcription Factors,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal,Root Catalog/Research Areas/Cancer/Cancer Transcription Factor

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SOX2
TargetSOX2
Protein SequenceSynthetic peptide located within the following region: AGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSH
Molecular Weight34kDa
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ANOP3, MCOPS3

Similar Products

  • SOX2 Rabbit Polyclonal Antibody [orb500791]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Human, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl
  • SOX2 Rabbit Polyclonal Antibody [orb573909]

    IHC,  WB

    Bovine, Canine, Equine, Goat, Porcine, Rabbit, Rat, Sheep, Zebrafish

    Frog, Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • SOX2 Antibody (N-term) [orb1931757]

    FC,  IF,  IHC-P,  WB

    Mouse, Other, Sheep, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    400 μl
  • SOX2 Antibody (N-term) [orb420684]

    FC,  IF,  IHC-P,  WB

    Mouse, Other, Sheep, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    80 μl
  • Anti-SOX2 Antibody [orb382052]

    IF,  IH,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SOX2 Rabbit Polyclonal Antibody

Sample Type: 2. mouse brain extracts (80 ug), 3. rat brain extract (80 ug), Primary Antibody Dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody Dilution: 1:20000.

SOX2 Rabbit Polyclonal Antibody

Sample Type: Human brain stem cells, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: SOX2: Red DAPI:Blue, Gene Name: SOX2.

SOX2 Rabbit Polyclonal Antibody

WB Suggested Anti-SOX2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate.

SOX2 Rabbit Polyclonal Antibody

WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human Hela.

SOX2 Rabbit Polyclonal Antibody

WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human Hela.

SOX2 Rabbit Polyclonal Antibody

WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human OVCAR-3.

SOX2 Rabbit Polyclonal Antibody

WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human OVCAR-3.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003097

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

SOX2 Rabbit Polyclonal Antibody (orb576582)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry