SOX9 monoclonal antibody (M02), clone 3C10

SKU: orb2292143

Description

Mouse monoclonal antibody raised against a partial recombinant SOX9.

Images & Validation

• Tested Applications: ELISA, IF, IHC-P, IP, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone No.: 3C10
• Immunogen: SOX9 (NP_000337, 400 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged SOX9 is 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to SOX9 on HepG2 cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to SOX9 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 0.7 ug/ml]

Immunoprecipitation of SOX9 transfected lysate using anti-SOX9 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SOX9 MaxPab rabbit polyclonal antibody.

SOX9 monoclonal antibody (M02), clone 3C10 Western Blot analysis of SOX9 expression in HepG2.

Western Blot analysis of SOX9 expression in transfected 293T cell line by SOX9 monoclonal antibody (M02), clone 3C10. Lane 1: SOX9 transfected lysate (56.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).

Quick Database Links

RefSeq (Protein):NP_000337