You have no items in your shopping cart.
Description
Research Area
Product Categories/Antibodies/Primary Antibodies,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human UNQ1887 |
| Target | SPPL3 |
| Protein Sequence | Synthetic peptide located within the following region: VMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHF |
| Molecular Weight | 42kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti DKFZp586C1324 antibody, anti IMP2 antibody, anti MDHV1887 antibody, anti MGC126674 antibody, anti MGC126676 antibody, anti MGC90402 antibody, anti PRO4332 antibody, anti PSL4 antibody, anti SPPL3 antibody, anti UNQ1887 antibody
Similar Products
−UNQ1887 Rabbit Polyclonal Antibody (Biotin) [orb2108926]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Rabbit
Polyclonal
Biotin
100 μlUNQ1887 Rabbit Polyclonal Antibody (FITC) [orb2108925]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Rabbit
Polyclonal
FITC
100 μlUNQ1887 Rabbit Polyclonal Antibody (HRP) [orb2108924]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Rabbit
Polyclonal
HRP
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

