SRD5A2 Rabbit Polyclonal Antibody

SKU: orb330376

Description

Rabbit polyclonal antibody to SRD5A2

Research Area

Product Categories/Antibodies/Primary Antibodies,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Signal Proteins,Root Catalog/Products/Polyclonal Antibodies/Membrane Protein,Root Catalog/Research Areas/Disease Related,Root Catalog/Research Areas/Prostate Cancer,Root Catalog/Research Areas/Cell Differentiation,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

−

Item 1 of 3

Tested Applications	IHC, WB
Reactivity	Human, Monkey
Predicted Reactivity	Porcine, Rabbit

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human SRD5A2
Target	SRD5A2
Protein Sequence	Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR
Molecular Weight	28kDa
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti MGC138457 antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

SRD5A2

UniProt

Q28892

RefSeq (Protein):NP_000339

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_000339

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry