You have no items in your shopping cart.
Description
Research Area
Product Categories/Antibodies/Primary Antibodies,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Transcription Factor,Root Catalog/Research Areas/Cancer,Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation,Root Catalog/Research Areas/Cell Biology,Root Catalog/Research Areas/Developmental Biology,Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Rat |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Sheep, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | SRP54A |
| Protein Sequence | Synthetic peptide located within the following region: DGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGL |
| Molecular Weight | 55kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti Srp54 antibody, anti Srp54a antibody
Similar Products
−SRP54A Rabbit Polyclonal Antibody (Biotin) [orb2125579]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Rabbit
Polyclonal
Biotin
100 μlSRP54A Rabbit Polyclonal Antibody (FITC) [orb2125578]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Rabbit
Polyclonal
FITC
100 μlSRP54A Rabbit Polyclonal Antibody (HRP) [orb2125577]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Rabbit
Polyclonal
HRP
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

