STAT3 monoclonal antibody (M02), clone 4D6

SKU: orb2292115

Description

Mouse monoclonal antibody raised against a partial recombinant STAT3.

Images & Validation

• Tested Applications: ELISA, IF, PLA, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 Kappa
• Clone No.: 4D6
• Immunogen: STAT3 (NP_003141, 670 a.a. ~ 769 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: LVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged STAT3 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to STAT3 on HeLa cell. [antibody concentration 10 ug/ml]

Proximity Ligation Analysis of protein-protein interactions between NFKB1 and STAT3. HeLa cells were stained with anti-NFKB1 rabbit purified polyclonal 1:1200 and anti-STAT3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

STAT3 monoclonal antibody (M02), clone 4D6 Western Blot analysis of STAT3 expression in HeLa.

Western Blot detection against Immunogen (36.74 KDa).

Quick Database Links

RefSeq (Protein):NP_003141