Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

STAT5B Rabbit Polyclonal Antibody

SKU: orb576926

Description

Rabbit polyclonal antibody to STAT5B

Research Area

Product Categories/Antibodies/Primary Antibodies,Epigenetics,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Signal Proteins,Root Catalog/Products/Polyclonal Antibodies/Lymphocyte Signaling,Root Catalog/Products/Polyclonal Antibodies/Membrane Protein,Root Catalog/Research Areas/Developmental Biology,Root Catalog/Research Areas/Immunohistochemistry,Root Catalog/Research Areas/Receptors,Root Catalog/Research Areas/Hypoxia,Root Catalog/Research Areas/Transcription Factors,Root Catalog/Research Areas/Cell Differentiation,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal,Root Catalog/Research Areas/Cancer/Cancer Transcription Factor

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human STAT5B
TargetSTAT5B
Protein SequenceSynthetic peptide located within the following region: AVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNP
Molecular Weight90kDa
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

STAT5, GHISID2

Similar Products

  • STAT5 Rabbit Polyclonal Antibody [orb11432]

    ELISA,  FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Anti-STAT5B Antibody [orb340708]

    IF,  IH,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl
  • Stat5a/b (phospho Ser726/731) rabbit pAb [orb770176]

    ELISA,  IF,  IHC-P,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Stat5 rabbit pAb [orb766393]

    ELISA,  IHC-P,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Anti-STAT5 (Phospho-Y694/699) Antibody [orb224181]

    IH,  WB

    Human, Mouse, Porcine, Rat, Sheep

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

STAT5B Rabbit Polyclonal Antibody

Anti-STAT5B antibody IHC staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

STAT5B Rabbit Polyclonal Antibody

Anti-STAT5B antibody IHC staining of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

STAT5B Rabbit Polyclonal Antibody

Rabbit Anti-STAT5B Antibody, Paraffin Embedded Tissue: Human Testis, Antibody Concentration: 5 ug/ml.

STAT5B Rabbit Polyclonal Antibody

WB Suggested Anti-STAT5B Antibody Titration: 1 ug/ml, Positive Control: 293T cells lysate. There is BioGPS gene expression data showing that STAT5B is expressed in HEK293T.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_036580

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

STAT5B Rabbit Polyclonal Antibody (orb576926)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry