Stk32b Rabbit Polyclonal Antibody

SKU: orb330699

Description

Rabbit polyclonal antibody to Stk32b

Research Area

Product Categories/Antibodies/Primary Antibodies,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation,Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions,Root Catalog/Research Areas/Phosphorylation,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Mouse
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide corresponding to a region of Mouse
Target	Stk32b
Protein Sequence	Synthetic peptide located within the following region: VERDEVRNVFRELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLR
Molecular Weight	46kDa
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti 2510009F08Rik antibody, anti STKG6 antibody, anti Stk32 antibody, anti YANK2 antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WB Suggested Anti-Stk32b Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Brain.

Quick Database Links

Gene Symbol

Stk32b

UniProt

Q9JJX8

RefSeq (Protein):NP_071861

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_071861

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols