STK38 monoclonal antibody (M01), clone 2G8-1F3

SKU: orb2291402

Description

Mouse monoclonal antibody raised against a full length recombinant STK38.

Images & Validation

• Tested Applications: ELISA, IF, IHC-P, IP, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a kappa
• Clone No.: 2G8-1F3
• Immunogen: STK38 (AAH12085, 1 a.a. ~ 465 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MAMTGSTPCSSMSNHTKERVTMTKVTLENFSSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPISEKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVAISNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged STK38 is 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to STK38 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to STK38 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue [antibody concentration 5 ug/ml]

Immunoprecipitation of STK38 transfected lysate using anti-STK38 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with STK38 MaxPab rabbit polyclonal antibody.

STK38 monoclonal antibody (M01), clone 2G8-1F3 Western Blot analysis of STK38 expression in Hela S3 NE.

STK38 monoclonal antibody (M01), clone 2G8-1F3. Western Blot analysis of STK38 expression in human kidney.

Western Blot analysis of STK38 expression in transfected 293T cell line by STK38 monoclonal antibody (M01), clone 2G8-1F3. Lane 1: STK38 transfected lysate(54.2 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (76.89 KDa).

Quick Database Links

RefSeq:AAH12085