Streptavidin Protein, S. avidinii, Recombinant (His)

SKU: orb1976320

Description

The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin). Streptavidin Protein, S. avidinii, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.5 kDa and the accession number is P22629.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: Streptomyces avidinii
• Biological Activity: The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin). Streptavidin Protein, S. avidinii, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.5 kDa and the accession number is P22629.
• Tag: N-6xHis
• Expression Region: 25-183 aa
• MW: 18.5 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P22629