SUFU Rabbit Polyclonal Antibody

SKU: orb577020

Description

Rabbit polyclonal antibody to SUFU

Research Area

Product Categories/Antibodies/Primary Antibodies,Cancer,Developmental Biology,Epigenetics,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Transcription Factor,Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation,Root Catalog/Research Areas/Developmental Biology,Root Catalog/Research Areas/Signal Transduction,Root Catalog/Research Areas/E3 & Ubiquitin,Root Catalog/Research Areas/Disease Related,Root Catalog/Research Areas/Immunohistochemistry,Root Catalog/Research Areas/Pathways In Cancer,Root Catalog/Research Areas/Transcription Factors,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

−

Item 1 of 3

Tested Applications	IHC, WB
Reactivity	Human, Mouse
Predicted Reactivity	Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human SUFU
Target	SUFU
Protein Sequence	Synthetic peptide located within the following region: LQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFD
Molecular Weight	54kDa
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

SUFUH, JBTS32, SUFUXL, PRO1280

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

Immunohistochemistry with Uterus tissue at an antibody concentration of 5 ug/ml using anti-SUFU antibody (orb577020).

WB Suggested Anti-SUFU Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

SUFU

UniProt

Q9UMX1

RefSeq (Protein):NP_057253

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_057253

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Find More Protocols