You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TAL1 |
| Target | TAL1 |
| Protein Sequence | Synthetic peptide located within the following region: QDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADGAGPR |
| Molecular Weight | 34kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−TAL1 Rabbit Polyclonal Antibody [orb592961]
IHC, WB
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μlTAL1 (phospho Ser122) rabbit pAb [orb770217]
ELISA, IHC-P, WB
Human, Mouse
Polyclonal
Unconjugated
100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Human Breast

Human Breast

Human Liver

Rabbit Anti-TAL1 Antibody, Paraffin Embedded Tissue: Human hepatocyte cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-TAL1 Antibody Titration: 0.6 ug/ml, Positive Control: Fetal Muscle cell lysate.
Documents Download
Request a Document
Protocol Information
TAL1 Rabbit Polyclonal Antibody (orb592842)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review










