You have no items in your shopping cart.
Description
Images & Validation
−Item 1 of 6
| Tested Applications | ELISA, WB |
|---|---|
| Reactivity | Human, Rat |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone No. | 1B10 |
| Immunogen | TAZ (AAH11515, 1 a.a. ~ 262 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTSEWAQAEAGPPGYPCPAGGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWVHIFPEGIGRLIAECHLNPIILPLWHVGEPGDGDREMASGVGGLGLPLVPGCPAPPHVWPSVHCAAGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Detection limit for recombinant GST tagged TAZ is approximately 3 ng/ml as a capture antibody.
TAZ monoclonal antibody (M12), clone 1B10 Western Blot analysis of TAZ expression in SW-13.
TAZ monoclonal antibody (M12), clone 1B10. Western Blot analysis of TAZ expression in human kidney.
TAZ monoclonal antibody (M12), clone 1B10. Western Blot analysis of TAZ expression in human uterus myoma.
TAZ monoclonal antibody (M12), clone 1B10. Western Blot analysis of TAZ expression in PC-12.
Western Blot detection against Immunogen (54.56 KDa).
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
WB
Western Blot (IB, immunoblot)
ELISA
Enzyme-linked Immunosorbent Assay (EIA)
TAZ monoclonal antibody (M12), clone 1B10 (orb2292095)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Choose Conjugation or Carrier Free Version
Free Secondary Antibody (20 ul)0/0
Please add an antibody product to your cart first.
Usually dispatched within 5-10 working days