You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | ELISA, WB |
|---|---|
| Reactivity | Human, Rat |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Polyclonal |
| Immunogen | TGFBR1 (NP_004603, 30 a.a. ~ 125 a.a) partial recombinant protein with GST tag. |
| Protein Sequence | GATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVE |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | 50 % glycerol |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

TGFBR1 polyclonal antibody (A01), Western Blot analysis of TGFBR1 expression in HepG2.

TGFBR1 polyclonal antibody (A01), Western Blot analysis of TGFBR1 expression in Hs 181.Tes.

TGFBR1 polyclonal antibody (A01), Western Blot analysis of TGFBR1 expression in human spleen.

TGFBR1 polyclonal antibody (A01), Western Blot analysis of TGFBR1 expression in RIN-m5F.

Western Blot detection against Immunogen (36.67 KDa).
Documents Download
Request a Document
Protocol Information
TGFBR1 polyclonal antibody (A01) (orb2292059)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review