TIMM8A monoclonal antibody (M01), clone 2F11

SKU: orb2293654

Description

Mouse monoclonal antibody raised against a partial recombinant TIMM8A.

Images & Validation

• Tested Applications: ELISA, IHC-P, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone No.: 2F11
• Immunogen: TIMM8A (NP_004076, 9 a.a. ~ 97 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: AAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged TIMM8A is approximately 0.3 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to TIMM8A on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]

TIMM8A monoclonal antibody (M01), clone 2F11 Western Blot analysis of TIMM8A expression in HeLa.

Western Blot analysis of TIMM8A expression in transfected 293T cell line by TIMM8A monoclonal antibody (M01), clone 2F11. Lane 1: TIMM8A transfected lysate (11 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.53 KDa).

Quick Database Links

RefSeq (Protein):NP_004076