TIMM9 monoclonal antibody (M01), clone 1D6

SKU: orb2291255

Description

Mouse monoclonal antibody raised against a full length recombinant TIMM9.

Images & Validation

• Tested Applications: ELISA, IHC-P, WB
• Reactivity: Human, Mouse, Rat

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone No.: 1D6
• Immunogen: TIMM9 (AAH20213, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged TIMM9 is approximately 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to TIMM9 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]

TIMM9 monoclonal antibody (M01), clone 1D6 Western Blot analysis of TIMM9 expression in IMR-32.

TIMM9 monoclonal antibody (M01), clone 1D6. Western Blot analysis of TIMM9 expression in NIH/3T3.

TIMM9 monoclonal antibody (M01), clone 1D6. Western Blot analysis of TIMM9 expression in PC-12.

TIMM9 monoclonal antibody (M01), clone 1D6. Western Blot analysis of TIMM9 expression in Raw 264.7.

Western Blot analysis of TIMM9 expression in transfected 293T cell line by TIMM9 monoclonal antibody (M01), clone 1D6. Lane 1: TIMM9 transfected lysate(10.4 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.53 KDa).

Quick Database Links

RefSeq:AAH20213