TNFSF8 monoclonal antibody (M02), clone 1E1

SKU: orb2294827

This product can be custom made

Description

Mouse monoclonal antibody raised against a partial recombinant TNFSF8.

Images & Validation

−

Item 1 of 2

Tested Applications	ELISA, WB
Reactivity	Human

Key Properties

−

Host	Mouse
Clonality	Monoclonal
Isotype	IgG1 Kappa
Clone No.	1E1
Immunogen	TNFSF8 (AAH93630.1, 63 a.a. ~ 234 a.a) partial recombinant protein.
Protein Sequence	QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	In 1x PBS, pH 7.4
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

TNFSF8 monoclonal antibody (M02), clone 1E1. Western Blot analysis of TNFSF8 expression in human placenta.

Western Blot detection against Immunogen (21.12 KDa).

Quick Database Links

RefSeq:AAH93630.1

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

RefSeq	AAH93630.1

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

ELISA

Enzyme-linked Immunosorbent Assay (EIA)

View Protocol

Find More Protocols