TNFSF8 monoclonal antibody (M01A), clone 2E11

SKU: orb2294828

This product can be custom made

Description

Mouse monoclonal antibody raised against a partial recombinant TNFSF8.

Images & Validation

−

Item 1 of 2

Tested Applications	ELISA, WB
Reactivity	Human

Key Properties

−

Host	Mouse
Clonality	Monoclonal
Isotype	IgM Kappa
Clone No.	2E11
Immunogen	TNFSF8 (NP_001235, 153 a.a. ~ 234 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Protein Sequence	NNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	In ascites fluid
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Western Blot analysis of TNFSF8 expression in transfected 293T cell line by TNFSF8 monoclonal antibody (M01A), clone 2E11. Lane 1: TNFSF8 transfected lysate (Predicted MW: 26 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (34.76 KDa).

Quick Database Links

RefSeq (Protein):NP_001235

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_001235

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

ELISA

Enzyme-linked Immunosorbent Assay (EIA)

View Protocol

Find More Protocols