TPSB2 Protein, Human, Recombinant (His & Myc)

SKU: orb1977661

Description

Tryptase is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. May play a role in innate immunity. TPSB2 Protein, Human, Recombinant (His & Myc) is expressed in yeast with C-6xHis-Myc tag. The predicted molecular weight is 31.2 kDa and the accession number is P20231.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: Human
• Biological Activity: Tryptase is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. May play a role in innate immunity. TPSB2 Protein, Human, Recombinant (His & Myc) is expressed in yeast with C-6xHis-Myc tag. The predicted molecular weight is 31.2 kDa and the accession number is P20231.
• Tag: C-6xHis-Myc
• Expression Region: 31-275 aa
• MW: 31.2 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P20231