You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | ELISA, IF, IHC-P, WB |
|---|---|
| Reactivity | Human, Mouse, Rat |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone No. | 2B2 |
| Immunogen | TUBB2A (AAH01194, 1 a.a. ~ 445 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNTNDLVSEYQQYQDATADEQGEFEEEEGEDEA |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Detection limit for recombinant GST tagged TUBB2A is 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to TUBB2A on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to TUBB2A on formalin-fixed paraffin-embedded human spleen. [antibody concentration 1.5 ug/ml]

TUBB2A monoclonal antibody (M03), clone 2B2. Western Blot analysis of TUBB2A expression in Jurkat.

TUBB2A monoclonal antibody (M03), clone 2B2. Western Blot analysis of TUBB2A expression in NIH/3T3.

TUBB2A monoclonal antibody (M03), clone 2B2. Western Blot analysis of TUBB2A expression in PC-12.

TUBB2A monoclonal antibody (M03), clone 2B2. Western Blot analysis of TUBB2A expression in Raw 264.7.

Western Blot analysis of TUBB2A expression in transfected 293T cell line by TUBB2A monoclonal antibody (M03), clone 2B2. Lane 1: TUBB2A transfected lysate (49.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (74.47 KDa).
Documents Download
Request a Document
Protocol Information
TUBB2A monoclonal antibody (M03), clone 2B2 (orb2292009)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review