TXN monoclonal antibody (M01), clone 2A7

SKU: orb2292003

Description

Mouse monoclonal antibody raised against a full length recombinant TXN.

Images & Validation

• Tested Applications: ELISA, IF, IP, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 Kappa
• Clone No.: 2A7
• Immunogen: TXN (AAH03377, 1 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged TXN is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to TXN on HeLa cell. [antibody concentration 10 ug/ml]

Immunoprecipitation of TXN transfected lysate using anti-TXN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TXN MaxPab rabbit polyclonal antibody.

TXN monoclonal antibody (M01), clone 2A7 Western Blot analysis of TXN expression in HeLa.

Western Blot analysis of TXN expression in transfected 293T cell line by TXN monoclonal antibody (M01), clone 2A7. Lane 1: TXN transfected lysate (11.7 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.29 KDa).

Quick Database Links

RefSeq:AAH03377