You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TYRP1 |
| Target | TYRP1 |
| Protein Sequence | Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP |
| Molecular Weight | 61 kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−TYRP1 Rabbit Polyclonal Antibody [orb158651]
IF, IHC-Fr, IHC-P, WB
Bovine, Equine, Rat
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlTYRP1 Rabbit Polyclonal Antibody [orb325135]
WB
Bovine, Canine, Equine, Goat, Guinea pig, Porcine, Rabbit, Rat, Sheep
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μlTyrp1 Rabbit Polyclonal Antibody [orb325136]
WB
Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Sheep, Zebrafish
Rat
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Protein is expressed as 61 kDa preprotein and is processed to approximately 56 kDa. It is also highly glycosylated.

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human 786-0, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/mL.

Sample Type: Human 721_B, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5.0 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%.

Rabbit Anti-TYRP1 Antibody, Paraffin Embedded Tissue: Human Skin, Antibody Concentration: 5 ug/mL.

WB Suggested Anti-TYRP1 Antibody Titration: 1 ug/mL, Positive Control: 721_B cell lysate.
Documents Download
Request a Document
Protocol Information
TYRP1 Rabbit Polyclonal Antibody (orb325137)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





