You have no items in your shopping cart.
Description
Research Area
,Recombinant-Protein
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Expression System | E. coli |
|---|---|
| Biological Origin | Human |
| Biological Activity | UBE2D3 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 32.7 kDa and the accession number is P61077. |
| Tag | N-6xHis-SUMO |
| Expression Region | 1-147 aa |
| MW | 32.7 kDa (predicted) |
| Purity | 98.00% |
| Protein Sequence | MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
UBE2D3 Protein, Human, Recombinant (His & SUMO) (orb1977631)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review