USP14 monoclonal antibody (M04), clone 6D6

SKU: orb2291767

Description

Mouse monoclonal antibody raised against a partial recombinant USP14.

Images & Validation

• Tested Applications: ELISA, IF, WB
• Reactivity: Human, Mouse, Rat

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone No.: 6D6
• Immunogen: USP14 (NP_005142, 395 a.a. ~ 494 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: PQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged USP14 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to USP14 on HeLa cell. [antibody concentration 20 ug/ml]

USP14 monoclonal antibody (M04), clone 6D6 Western Blot analysis of USP14 expression in HeLa.

USP14 monoclonal antibody (M04), clone 6D6. Western Blot analysis of USP14 expression in NIH/3T3.

USP14 monoclonal antibody (M04), clone 6D6. Western Blot analysis of USP14 expression in PC-12.

USP14 monoclonal antibody (M04), clone 6D6. Western Blot analysis of USP14 expression in Raw 264.7.

Western Blot analysis of USP14 expression in transfected 293T cell line by USP14 monoclonal antibody (M04), clone 6D6. Lane 1: USP14 transfected lysate (56.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).

Quick Database Links

RefSeq (Protein):NP_005142