Vaccinia virus (strain LC16m8) B5 Protein (His)

SKU: orb1976241

Description

Regulation of plaque size and host range. In this strain the truncated ps/hr protein is probably not functional. Vaccinia virus (strain LC16m8) B5 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 10.6 kDa and the accession number is P24284.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: VACV
• Biological Activity: Regulation of plaque size and host range. In this strain the truncated ps/hr protein is probably not functional. Vaccinia virus (strain LC16m8) B5 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 10.6 kDa and the accession number is P24284.
• Tag: N-6xHis
• Expression Region: 18-92 aa
• MW: 10.6 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYK

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P24284