Vaccinia virus (strain Western Reserve) L1 Protein (His)

SKU: orb1976245

Description

Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell. Vaccinia virus (strain Western Reserve) L1 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 21.3 kDa and the accession number is P07612.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: VACV
• Biological Activity: Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell. Vaccinia virus (strain Western Reserve) L1 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 21.3 kDa and the accession number is P07612.
• Tag: N-6xHis
• Expression Region: 2-183 aa
• MW: 21.3 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTG

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P07612