Vaccinia virus (strain Western Reserve) K3 Protein (His)

SKU: orb1976250

Description

Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff. Vaccinia virus (strain Western Reserve) K3 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 12.6 kDa and the accession number is P18378.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: VACV
• Biological Activity: Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff. Vaccinia virus (strain Western Reserve) K3 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 12.6 kDa and the accession number is P18378.
• Tag: N-6xHis
• Expression Region: 1-88 aa
• MW: 12.6 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P18378