Vaccinia virus (strain Western Reserve) OPG161 Protein (His)

SKU: orb1976257

Description

Coordinates the incorporation of A36 into wrapped enveloped virion (EV) membranes and, subsequently, the production of actin tails. Therefore plays an essential role in efficient cell-to-cell spread of viral particles. Vaccinia virus (strain Western Reserve) OPG161 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 16.2 kDa and the accession number is P68617.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: VACV
• Biological Activity: Coordinates the incorporation of A36 into wrapped enveloped virion (EV) membranes and, subsequently, the production of actin tails. Therefore plays an essential role in efficient cell-to-cell spread of viral particles. Vaccinia virus (strain Western Reserve) OPG161 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 16.2 kDa and the accession number is P68617.
• Tag: N-6xHis
• Expression Region: 57-185 aa
• MW: 16.2 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P68617