Variola virus (isolate Human/India/Ind3/1967) Pro-VGF Protein (His & Myc)

SKU: orb1976232

Description

Variola virus (isolate Human/India/Ind3/1967) Pro-VGF Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 16.6 kDa and the accession number is P0DOP9.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Key Properties

• Expression System: E. coli
• Biological Origin: VARV
• Biological Activity: Variola virus (isolate Human/India/Ind3/1967) Pro-VGF Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 16.6 kDa and the accession number is P0DOP9.
• Tag: N-10xHis, C-Myc
• Expression Region: 19-100 aa
• MW: 16.6 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: ANSGNAIETTLSEITNTTTDIPAIRLCGPEGDRYCFHGICIHARDIDGMYCRCSHGYTGIRCQHVVLVDYQRSEKPNTTTSY

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P0DOP9