VEGFA Rabbit Polyclonal Antibody

SKU: orb584861

Description

Rabbit polyclonal antibody to VEGFA

Research Area

Product Categories/Antibodies/Primary Antibodies,Cancer,Developmental Biology,Epigenetics,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Research Areas/Cancer,Root Catalog/Products/Polyclonal Antibodies/Cell Adhesion,Root Catalog/Products/Polyclonal Antibodies/Growth Factors & Hormones,Root Catalog/Research Areas/Apoptosis,Root Catalog/Research Areas/Disease Related,Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

−

Item 1 of 2

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Human

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Human VEGFA
Target	VEGFA
Protein Sequence	Synthetic peptide located within the following region: ECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSL
Molecular Weight	35kDa
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

VPF, VEGF, MVCD1

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: Jurkat Whole cell lysates, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-VEGFA Antibody, Catalog Number: orb584861, Formalin Fixed Paraffin Embedded Tissue: Human Thyroid Gland Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Quick Database Links

Gene Symbol

VEGFA

UniProt

P15692

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols