Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

VIP (human, mouse, rat) . AcOH [RLF-100]

SKU: orb1227501

Description

VIP (human, mouse, rat) . AcOH [RLF-100]

Images & Validation

Key Properties

Molecular Weight3325.8 . 60.0 / sequence: H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
Puritygreater than or equal to 98% (HPLC)
CAS Number444827-29-5 | 40077-57-4 (free base)
FormulaC147H238N44O42S . C2H4O2
SMILESO=C([C@H]([C@@H](C)CC)NC([C@H](CO)NC([C@H](CC(N)=O)NC([C@H](CC(C)C)NC([C@H](CC(C=C1)=CC=C1O)NC([C@H](CCCCN)NC([C@H](CCCCN)NC([C@H](C(C)C)NC([C@H](C)NC([C@H](CCSC)NC([C@H](CCC(N)=O)NC([C@H](CCCCN)NC(C(CCCNC(N)=N)NC([C@H](CC(C)C)NC([C@H](CCCNC(N)=N)NC([C@H]([C@@H](C)O)NC([C@H](CC(C=C2)=CC=C2O)NC([C@H](CC(N)=O)NC([C@H](CC(O)=O)NC([C@H]([C@@H](C)O)N([H])C([C@H](CC3=CC=CC=C3)NC([C@H](C(C)C)NC([C@H](C)NC([C@H](CC(O)=O)NC([C@H](CO)NC([C@H](CC4=CN=CN4)N)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)N[C@H](C(N[C@H](C(N)=O)CC(N)=O)=O)CC(C)C.CC(O)=O

Storage & Handling

StorageShort Term Storage: +4C. Long Term Storage: -2°C. Handling Advice: Keep cool and dry. Use/Stability: Stable for at least 2 years after receipt when stored at -2°C.
Form/AppearanceLyophilized
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Aviptadil; HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2; Vasoactive Intestinal Peptide; Vasoactive Intestinal Octacosapeptide
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

VIP (human, mouse, rat) . AcOH [RLF-100]

Key Properties

No computed properties available.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

VIP (human, mouse, rat) . AcOH [RLF-100] (orb1227501)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 mg
$ 590.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry