Viscumin Protein, Viscum album, Recombinant (His)

SKU: orb1976214

Description

The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits by removing adenine from position 4,324 of 28S rRNA. The B chain binds to cell receptors and probably facilitates the entry into the cell of the A chain; B chains are also responsible for cell agglutination (lectin activity). Inhibits growth of the human tumor cell line Molt4. Viscumin Protein, Viscum album, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 30.4 kDa and the accession number is P81446.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: Viscum album
• Tag: N-6xHis
• Expression Region: 34-287 aa
• MW: 30.4 kDa (predicted)
• Purity: > 90% as determined by SDS-PAGE
• Protein Sequence: YERLRLRVTHQTTGEEYFRFITLLRDYVSSGSFSNEIPLLRQSTIPVSDAQRFVLVELTNEGGDSITAAIDVTNLYVVAYQAGDQSYFLRDAPRGAETHLFTGTTRSSLPFNGSYPDLERYAGHRDQIPLGIDQLIQSVTALRFPGGSTRTQARSILILIQMISEAARFNPILWRARQYINSGASFLPDVYMLELETSWGQQSTQVQQSTDGVFNNPIRLAIPPGNFVTLTNVRDVIASLAIMLFVCGERPSSS

Storage & Handling

• Storage: -20°C
• Form/Appearance: Lyophilized from Tris-based buffer, 50% glycerol
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P81446