You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | Wdfy1 |
| Protein Sequence | Synthetic peptide located within the following region: ASEDRTIRVWLKRDSGQYWPSIYHTMASPCSAMAYHHDSRRIFVGQDNGA |
| Molecular Weight | 46 kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−FENS1 Rabbit Polyclonal Antibody [orb156858]
IF, IHC-Fr, IHC-P, WB
Bovine, Canine, Equine, Porcine, Rabbit
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl, 200 μlWDFY1 Rabbit Polyclonal Antibody [orb583575]
WB
Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
Human
Rabbit
Polyclonal
Unconjugated
100 μlFENS1 Rabbit Polyclonal Antibody (BF647) [orb2527286]
IF
Bovine, Canine, Equine, Porcine, Rabbit
Human, Mouse, Rat
Rabbit
Polyclonal
BF647
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Mouse whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The canonical isoform of 46 kDa is present as well as a second isoform around ~25 kDa.

Rabbit Anti-Wdfy1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Prostate, Primary antibody Concentration: 10 ug/ml.

Rabbit Anti-Wdfy1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 10 ug/ml.

WB Suggested Anti-Wdfy1 Antibody, Titration: 1.0 ug/ml, Positive Control: Human kidney.

WB Suggested Anti-Wdfy1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Heart.
Documents Download
Request a Document
Protocol Information
Wdfy1 Rabbit Polyclonal Antibody (orb583576)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review






