You have no items in your shopping cart.
Description
Research Area
Product Categories/Antibodies/Primary Antibodies,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Various,Root Catalog/Research Areas/Tissue Specific & Cell Marker,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Canine, Porcine |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | XAGE1D |
| Protein Sequence | Synthetic peptide located within the following region: QCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAGEEQPQV |
| Molecular Weight | 18kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti CT12.1D antibody, anti CTP9 antibody, anti XAGE1A antibody, anti XAGE1B antibody, anti XAGE1C antibody, anti XAGE1E antibody, anti CT12.1 antibody
Similar Products
−XAGE1D Rabbit Polyclonal Antibody (Biotin) [orb2096980]
WB
Canine, Human, Porcine
Rabbit
Polyclonal
Biotin
100 μlXAGE1D Rabbit Polyclonal Antibody (FITC) [orb2096979]
WB
Canine, Human, Porcine
Rabbit
Polyclonal
FITC
100 μlXAGE1D Rabbit Polyclonal Antibody (HRP) [orb2096978]
WB
Canine, Human, Porcine
Rabbit
Polyclonal
HRP
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WB Suggested Anti-XAGE1D Antibody, Titration: 1.0 ug/mL, Positive Control: Fetal kidney.
Documents Download
Datasheet
Product Information
Request a Document
XAGE1D Rabbit Polyclonal Antibody (orb326368)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review