Yeast MDR1 protein

SKU: orb246715

Description

Recombinant Entamoeba histolytica MDR1 protein

Research Area

Product Categories/Products/Proteins,Others

Images & Validation

• Application Notes:
  This is His-tag protein

Key Properties

• Source: Yeast
• Biological Origin: Entamoeba histolytica
• Tag: N-terminal 6xHis-tagged
• Expression Region: 1-114aa
• Protein Length: Full Length
• Endotoxins: Not test.
• MW: 14.5 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: SGCGKSTTIQLIQRNYEPNGGRVTLDGKDIRELNIKWLRNQIGLVGQEPVLFAGTIRENIMLGAKEGETLSKDEMIECAKMANAHEFVSKLAEGYDTLIGEKGALLSGGQRQRI

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ABC20 protein, ABCB1 protein, ABCB1B protein, CD243 protein, CLCS protein, GP170 protein, IBD13 protein, PGY1 protein, ATP-binding cassette sub-family B member 1 protein, ATP-binding cassette, sub-family B (MDR/TAP), member 1 protein, CD243 antigen protein, colchicin sensitivity protein, doxorubicin resistance protein, multidrug resistance protein 1 protein, P-glycoprotein 1 protein, P-gp protein, PGY1P-GP protein, ATP binding cassette, sub family B (MDR/TAP), member 1 protein, MDR1 protein, MDR 1 protein, Multidrug resistance 1 protein, P glycoprotein 1 protein, P gp protein

Quick Database Links

UniProt

P16875